Pineal gland comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-02-19. Where a claim depends on a specific study, the study is described rather than over-claimed.
Reversed-phase high-performance liquid chromatography is the standard approach for assessing purity, usually with ultraviolet detection near 214 nm, where the peptide bond absorbs. Mass spectrometry, most often with electrospray ionization, confirms the molecular mass and helps reveal truncation or deletion byproducts. Amino acid analysis can verify composition, and counterion content is sometimes measured because peptides purified with trifluoroacetic acid retain variable amounts of that salt. Purity figures reported without a stated method and detection wavelength are difficult to interpret.
Material sold for research use varies widely in documented quality. A useful verification package includes a certificate of analysis that states peptide content rather than only net weight, the chromatographic method and column used, and a mass spectrum consistent with the expected mass. Independent testing by a third-party laboratory is occasionally reported. Statements of identity resting only on a supplier label provide little assurance, and the gap between nominal mass and actual peptide content can be substantial once counterions and residual water are counted.
Peptides of this size are generally stable as dry solids but degrade in solution over time. The principal routes are hydrolysis of the peptide backbone and oxidation, with hydrolysis favoured by elevated temperature and extreme pH. Aqueous solutions held at room temperature can show measurable loss of purity within days, while frozen aliquots are considerably more durable. Because the sequence contains neither cysteine nor methionine, oxidation is less of a concern than for many other peptides, but pH control during handling still matters.
Identity confirmation uses mass spectrometry, usually electrospray ionisation in positive mode or matrix-assisted laser desorption. The protonated free peptide produces a signal near three hundred and ninety-one daltons, while salt adducts shift that value slightly. Tandem mass spectrometry or amino acid analysis supplies sequence-level confirmation, which a single mass measurement cannot. Peptides containing aspartate can cyclise into succinimide intermediates that hydrolyse to isoaspartate isomers of identical mass. Because those isomers are difficult to separate chromatographically, identity and purity results carry more weight when interpreted together.
Storage practice centres on limiting moisture, oxygen, and repeated temperature cycling. Freeze-dried powder is generally held desiccated at minus twenty degrees Celsius or colder and protected from light. Reconstituted solutions are markedly less stable, and the aspartate-glycine junction is prone to succinimide formation at neutral to mildly alkaline pH. Portioning material into single-use aliquots reduces degradation compared with repeated freeze-thaw cycles. Stability data specific to this tetrapeptide remain scarce, so most handling guidance is extrapolated from general peptide chemistry rather than measured directly.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized solid |
| Solubility | Freely soluble in water | Also dissolves in polar organic solvents |
| Typical storage temperature | −20 °C or below | Sealed, desiccated, protected from light |
| Primary purity assay | Reversed-phase HPLC | Ultraviolet detection near 214 nm |
| Identity confirmation | Mass spectrometry | Electrospray ionization commonly used |
Verification of a sample usually begins with reversed-phase high-performance liquid chromatography, which resolves the peptide from truncated sequences and other impurities and expresses purity as a percentage of total peak area. Mass spectrometry by electrospray ionisation or matrix-assisted laser desorption supplies an independent check, because the measured mass can be compared against the theoretical value for AEDG. Amino acid analysis or tandem mass spectrometry sequencing can confirm residue order. Each of these methods answers a different question: a purity figure does not establish identity, and an identity match does not establish how much of the material is intact peptide.
The molecule is a short, linear, hydrophilic peptide that dissolves readily in water or aqueous buffer. Its principal chemical liabilities are hydrolytic rather than oxidative, since it contains no cysteine, methionine, or tryptophan residues. The aspartate–glycine step is a recognised site for aspartimide formation under mildly acidic or basic conditions, generating isoaspartate and succinimide-related products over time. Desiccated lyophilised powder held at −20 °C is comparatively stable, whereas dilute solutions degrade faster and are best frozen as single-use aliquots rather than thawed repeatedly.
Epitalon emerged from research conducted in Saint Petersburg by Vladimir Khavinson and colleagues, who studied short peptides as potential regulators of aging. The work built on epithalamin, a pineal gland extract reported to influence neuroendocrine function. Epitalon was designed as a synthetic counterpart with a defined sequence, allowing reproducible experiments that extracts could not support. Early publications described effects on melatonin rhythms and lifespan in animal models. These findings circulated mainly in Russian-language journals during the 1990s, which limited their visibility among English-speaking researchers.
The most widely cited claim is that epitalon activates telomerase and thereby extends telomere length. Supporting evidence comes largely from cultured human cells, where treatment was associated with increased telomerase activity and delayed replicative senescence. Telomerase activation is a biologically consequential effect, since the enzyme is largely silenced in most somatic cells. However, the route by which a short peptide would reach and act on the enzyme's regulatory machinery has not been established. Independent replication in human trials is scarce, so the link between cell-culture observations and whole-body aging remains an open question.
Human data are limited to small studies, often without the randomization, blinding, or control groups expected in contemporary clinical research. Reported outcomes have included changes in melatonin levels, immune markers, and subjective measures, but sample sizes were generally too small to support firm conclusions. Some reviews treat the peptide as promising while noting methodological weaknesses; others question whether the observed effects are specific. The compound is frequently discussed in longevity-focused communities, where enthusiasm often outpaces the published evidence. Separating established findings from speculation is therefore important when reading summaries of this research.
Potency is the amount of drug needed to give a certain therapeutic effect. It is affected by the drug's affinity to the receptors and the number of receptors available. For antagonists, half maximal inhibitory concentration (IC50) is used to measure the potency of antagonists. IC50 means the concentration of antagonist needed to give a 50% inhibition. It can be directly compared with EC50, which is commonly used to measure the potency of an agonist. EC50 means the concentration of agonist needed to give a 50% response. IC50 is significant in determining the optimal dose of antagonist. A high concentration of an antagonist in the body may result in toxicity in the cell and damage the cell membrane. A lower IC50 means the inhibitory effect can be met with a lower concentration of antagonist and, therefore a lower risk of toxicity. For example, the IC50 of antagonists on cancer cell growth is essential for determining the optimal dose which inhibits cancer cells while inducing less harmful systemic effects in the body.
Case report forms are manually filled at site and mailed to the company for which trial is being performed. The data on forms is transferred to the CDMS tool through data entry. The most popular method being double data entry where two different data entry operators enter the data in the system independently and both the entries are compared by the system. In case the entry of a value conflicts, system alerts and a verification can be done manually. Another method is Single Data Entry. The data in CDMS are then transferred for the data validation. Also, in these systems during validation the data clarification from sites are done through paper forms, which are printed with the problem description and sent to the investigator site and the site responds by answering on forms and mailing them back.
It has also been discovered that GLD2 has medical uses. For example, such enzyme is overexpressed in patients who suffer from cancer; that's why it can be used as a prognostic factor for early appearance in breast cancer patients. Moreover, PAP activity is used to measure the effect of anticancer drugs as etoposide and cordycepin in two carcinoma cell lines: HeLa, which is the human epithelioid cervix carcinoma, and MCF-7 (human breast cancer). However, in spite its utilities it can also be involved in the expression of several common diseases such as: leukemia, liver cirrhosis, brain injuries, hepatitis and in some cases infertility in male patients.
In 2007, the Alcohol and Tobacco Tax and Trade Bureau (TTB) effectively lifted the long-standing absinthe ban, and it has since approved many brands for sale in the US market. This was made possible partly through the TTB's clarification of the Food and Drug Administration's (FDA) thujone content regulations, which specify that finished food and beverages that contain Artemisia species must be thujone-free. In this context, the TTB considers a product thujone-free if the thujone content is less than 10 ppm (equal to 10 mg/kg). This is verified through the use of gas chromatography–mass spectrometry. The brands Kübler and Lucid and their lawyers did most of the work to get absinthe legalized in the U.S., over the 2004–2007 time period. In the U.S., 5 March sometimes is referred to as "National Absinthe Day", as it was the day the 95-year ban on absinthe was finally lifted. The import, distribution, and sale of absinthe are permitted subject to the following restrictions:
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Acids play important roles in the human body. The hydrochloric acid present in the stomach aids digestion by breaking down large and complex food molecules. Amino acids are required for synthesis of proteins required for growth and repair of body tissues. Fatty acids are also required for growth and repair of body tissues. Nucleic acids are important for the manufacturing of DNA and RNA and transmitting of traits to offspring through genes. Carbonic acid is important for maintenance of pH equilibrium in the body. Human bodies contain a variety of organic and inorganic compounds, among those dicarboxylic acids play an essential role in many biological behaviors. Many of those acids are amino acids, which mainly serve as materials for the synthesis of proteins. Other weak acids serve as buffers with their conjugate bases to keep the body's pH from undergoing large scale changes that would be harmful to cells. The rest of the dicarboxylic acids also participate in the synthesis of various biologically important compounds in human bodies.
Chromosome 11 open reading frame 91, or C11orf91 is a protein which in humans is encoded by the C11orf91 gene. The C11orf91 gene consists of 5159 nucleotides with an mRNA of approximately 836 base pairs. There is one exon found in the C11orf91 gene. The cytogenetic band location of C11orf91 is 11p13 and is located on the minus strand of the DNA . Annotated depiction of the C11orf91 mRNA and amino acid protein sequences. The C11orf91 gene encodes a protein that is 193 amino acids in length. The C11orf91 protein contains a domain of unknown function, DUF5529, that spans nearly the entire protein. RBMX protein binding sites were found to be highly conserved in several structures of human C11orf91 3'UTR and 5' UTR. C11orf91 is rich in serine and proline and poor in valine and asparagine. There is a proline rich region found in the middle of the C11orf91. The human C11orf91 protein is approximately 20 kDal and has an isoelectric point around 9. Human C11orf91 protein is predicted to be localized in vesicles. C11orf91 has two helices located near the C-terminus and no beta sheets.
Sources: en.wikipedia.org
Years after the conference, people ascribed a large amount of significance to it. According to Paul Berg and Maxine Singer in 1995, the conference marked the beginning of an exceptional era for both science and the public discussion of science policy. The guidelines devised by the conference enabled scientists to conduct experiments with recombinant DNA technology, which by 1995 dominated biological research. This research, in turn, increased knowledge about fundamental life processes, such as the cell cycle. Additionally, the conference, along with public debates on recombinant DNA, increased public interest in biomedical research and molecular genetics. For this reason, by 1995, genetics and its vocabulary had become a part of the daily press and television news. This, in turn, stimulated knowledgeable public discussion about some of the social, political, and environmental issues that emerged from genetic medicine and the use of genetically modified plants in agriculture. Another significant outcome of the conference was the precedent it set about how to respond to changes in scientific knowledge. According to the conference, the proper response to new scientific knowledge was to develop guidelines that governed how to regulate it.
UniProt is an online repository of protein sequence and annotation data, distributed in UniProt Knowledgebase (UniProt KB), UniProt Reference Clusters (UniRef) and UniProt Archive (UniParc) databases. Originally conceived as the individual ventures of EMBL-EBI, Swiss Institute of Bioinformatics (SIB) (together maintaining Swiss-Prot and TrEMBL) and Protein Information Resource (PIR) (housing Protein Sequence Database), the increase in the global protein data generation led to their collaboration in the creation of UniProt in 2002. The protein entries stored in UniProt are cataloged by a unique UniProt identifier. The annotation data collected for the each entry are organized in logical sections (e.g. protein function, structure, expression, sequence or relevant publications), allowing a coordinated overview about the protein of interest. Links to external databases and original sources of data are also provided. In addition to standard search by the protein name/identifier, UniProt webpage houses tools for BLAST searching, sequence alignment or searching for proteins containing specific peptides.
The Bergmann degradation makes use of the azide degradation described by the Curtius rearrangement. Curtius also attempted to degrade benzoylated amino acids; however, his method involved splitting the carbamate with strongly energetic treatment with acids, which lead to decomposition of the resultant aldehyde and acid amides. This convinced Bergmann that Curtius' azide degradation could be followed by treatment with benzyl alcohol (his carbobenzoxy method) to isolate the resultant amino acid aldehyde and residual peptide amide for sequencing purposes.
Sources: en.wikipedia.org
The powder is normally kept at −20 °C or below in a sealed, moisture-protected container. Letting the vial reach room temperature before opening helps prevent condensation on the contents.
Reversed-phase HPLC with ultraviolet detection is the usual approach, often paired with mass spectrometry. Together the two methods address both chromatographic purity and molecular identity.
Differences arise from the analytical method, the detection wavelength, and whether the number refers to the peptide or to total powder mass. Counterion and water content can lower the actual peptide fraction considerably.
Reversed-phase high-performance liquid chromatography with ultraviolet detection at 214 nanometres is the usual approach. Peak area percentage provides a purity figure relative to other components in the sample. Mass spectrometry is then applied to confirm identity.